PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I02057.1.p
Common NameEUGRSUZ_I02057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 209aa    MW: 24381.4 Da    PI: 10.0763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I02057.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+ll ++v ++G g+W+++ r  g++R++k+c++rw +yl
  Eucgr.I02057.1.p 16 KGPWTPEEDKLLSEYVGLHGEGRWSSVGRSAGLNRSGKSCRLRWVNYL 63
                      79********************************************97 PP

2Myb_DNA-binding52.31.3e-1669113147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg  T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++
  Eucgr.I02057.1.p  69 RGQITPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNYWRTH 113
                       7888******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8051163IPR017930Myb domain
SuperFamilySSF466895.99E-3113110IPR009057Homeodomain-like
SMARTSM007171.7E-151565IPR001005SANT/Myb domain
PfamPF002492.5E-171663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-221770IPR009057Homeodomain-like
CDDcd001671.93E-101863No hitNo description
PROSITE profilePS5129424.57264118IPR017930Myb domain
SMARTSM007175.2E-1468116IPR001005SANT/Myb domain
PfamPF002491.8E-1469113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2471117IPR009057Homeodomain-like
CDDcd001672.11E-973114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MVGMMGWGGQ EQGWRKGPWT PEEDKLLSEY VGLHGEGRWS SVGRSAGLNR SGKSCRLRWV  60
NYLRPGLKRG QITPQEEGII IELHALWGNK WSTIARYLPG RTDNEIKNYW RTHFKKKDRS  120
AHKQERRSRR AQGIKQNLKH HQQQRQQQEA QPNDRQERIM EETRAVKEAV PLHATAEDHC  180
LPVQEVPSWS DFVGDQVLWG GLWNFDDTH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24161177107B-MYB
1h8a_C2e-241611727127MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I02057.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0349771e-53AB034977.1 Melaleuca cajuputi DNA, microsatellite at the locus Sal-3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029405.11e-143PREDICTED: transcription factor MYB57
SwissprotQ9LX825e-51MYB48_ARATH; Transcription factor MYB48
TrEMBLA0A059ARJ31e-154A0A059ARJ3_EUCGR; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000034795e-81(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.12e-69myb domain protein 121